For research use only
| Cat No. | ABC-X0396F |
| Product Type | Overexpression Stable Cell Lines |
| Cell Type | Epithelial |
| Species | Hamster |
| Host Cell | CHO-K1 |
| Source Organ | Ovary |
| Disease | Normal |
| Storage | Liquid Nitrogen |
A monoclonal cell line stably expressing TROP2 constructed using viral technology based on CHO-K1 cells.
A monoclonal cell line stably expressing TROP2 constructed using viral technology based on CHO-K1 cells.
Cynomolgus_Trop2 Amino Acid Sequence: MARGPGLAPPPLRLPLLLLLLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGVAVDCSTLTSECLLLKARMSAPKNARTLVRPNEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDVKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAVIVVVVVALVAGVAVLVISNRRKSGKYKKVEIKELGELRKEPSLKHF
| Species | Hamster |
| Cat.No | ABC-X0396F |
| Quality Control | All cells test negative for mycoplasma, bacteria, yeast, and fungi. |
| Product Category | Transfected Stable Cell Lines |
| Size/Quantity | 1 vial |
| Cell Type | Epithelial |
| Growth Mode | Adherent |
| Shipping Info | Dry Ice |
| Growth Conditions | 37 ℃, 5% CO2 |
| Source Organ | Ovary |
| Disease | Normal |
| Biosafety Level | 1 |
| Storage | Liquid Nitrogen |
| Product Type | Overexpression Stable Cell Lines |
| Host Cell | CHO-K1 |
For research use only
When you publish your research, please cite our product as “AcceGen Biotech Cat.# XXX-0000”. In return, we’ll give you a $100 coupon. Simply click here and submit your paper’s PubMed ID (PMID).