1
Discover top-quality products tailored for scientific and medical research. Request a personalized quote today 
to enhance your projects.
| Species | Hamster  | 
                
| Cat.No | ABC-X0507F  | 
                
| Quality Control | All cells test negative for mycoplasma, bacteria, yeast, and fungi.  | 
                
| Product Category | Transfected Stable Cell Lines | 
| Size/Quantity | 1 vial  | 
                
| Cell Type | Epithelial  | 
                
| Shipping Info | Dry Ice  | 
                
| Growth Conditions | 37 ℃, 5% CO2  | 
                
| Source Organ | Ovary  | 
                
| Disease | Normal  | 
                
| Biosafety Level | 1  | 
                
| Storage | Liquid Nitrogen  | 
                
| Product Type | Overexpression Stable Cell Lines  | 
                
| Host Cell | CHO-K1  | 
                  
Stable monoclonal cell line stably expressing Cynomolgus_CD40 constructed using lentiviral technology based on CHO-K1 cells.
Cynomolgus_CD40 Amino acid sequence (A0A2K5V585):  MVRLPLQCVLWGCLLTAVYPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETRCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGLHCTSESCESCVPHRSCLPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCRPWTSCETKDLVVQQAGTNKTDVVCGPQDRQRALVVIPICLGILFVILLLVLVFIKKVAKKPNDKVPHPKQEPQEINFPDDLPGSNPAAPVQETLHGCQPVTQEDGKESRISVQERQ
When you publish your research, please cite our product as “AcceGen Biotech Cat.# XXX-0000”. In return, we’ll give you a $100 coupon. Simply click here and submit your paper’s PubMed ID (PMID).
For research use only