For research use only
| Cat No. | ABC-RC066F |
| Product Type | Reporter Stable Cell Lines |
| Cell Type | Epithelial-like |
| Species | Mouse |
| Host Cell | B16-F10 |
| Source Organ | Skin |
| Disease | Melanoma |
| Storage | Liquid Nitrogen |
A monoclonal cell line stably expressing MICA constructed using viral technology based onB16-F10 cells.
A monoclonal cell line stably expressing MICA constructed using viral technology based on B16-F10 cells.
MICA*001 Amino Acid Sequence: MGLGPVFLLLAGIFPFAPPGAAAEPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQTFHVSAVAAAAIFVIIIFYVRCCKKKTSAAEGPELVSLQVLDQHPVGTSDHRDATQLGFQPLMSDLGSTGSTEGA
| Species | Mouse |
| Cat.No | ABC-RC066F |
| Quality Control | All cells test negative for mycoplasma, bacteria, yeast, and fungi. |
| Product Category | Transfected Stable Cell Lines |
| Size/Quantity | 1 vial |
| Cell Type | Epithelial-like |
| Growth Mode | Adherent |
| Shipping Info | Dry Ice |
| Growth Conditions | 37 ℃, 5% CO2 |
| Source Organ | Skin |
| Disease | Melanoma |
| Biosafety Level | 1 |
| Storage | Liquid Nitrogen |
| Product Type | Reporter Stable Cell Lines |
| Host Cell | B16-F10 |
For research use only
When you publish your research, please cite our product as “AcceGen Biotech Cat.# XXX-0000”. In return, we’ll give you a $100 coupon. Simply click here and submit your paper’s PubMed ID (PMID).