For research use only
| Cat No. | ABC-X0496F |
| Product Type | Overexpression Stable Cell Lines |
| Cell Type | Epithelial-like |
| Species | Mouse |
| Host Cell | MC38 |
| Source Organ | Colon |
| Disease | Colon Adenocarcinoma |
| Storage | Liquid Nitrogen |
Established monoclonal cell line stably expressing CD24 based on MC38 cells using lentivirus technology.
Established monoclonal cell line stably expressing CD24 based on MC38 cells using lentivirus technology.
CD24 Amino acid sequence: MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAGGALQSTASLFVVSLSLLHLYS
| Species | Mouse |
| Cat.No | ABC-X0496F |
| Product Category | Transfected Stable Cell Lines |
| Size/Quantity | 1 vial |
| Cell Type | Epithelial-like |
| Growth Mode | Adherent |
| Shipping Info | Dry Ice |
| Growth Conditions | 37 ℃, 5% CO2 |
| Source Organ | Colon |
| Disease | Colon Adenocarcinoma |
| Biosafety Level | 1 |
| Storage | Liquid Nitrogen |
| Product Type | Overexpression Stable Cell Lines |
| Host Cell | MC38 |
| Quality Control | All cells test negative for mycoplasma, bacteria, yeast, and fungi. |
When you publish your research, please cite our product as “AcceGen Biotech Cat.# XXX-0000”. In return, we’ll give you a $200 coupon. Simply click here and submit your paper’s PubMed ID (PMID).